PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_017899-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 241aa    MW: 27170.5 Da    PI: 6.7961
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_017899-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34e-191560147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEdell + v+++G ++W+ I++ ++ gR++k+c++rw + 
  AHYPO_017899-RA 15 KGPWSPEEDELLQRMVQKYGARNWSVISKSIP-GRSGKSCRLRWCNQ 60
                     79******************************.***********985 PP

2Myb_DNA-binding63.63.9e-2069111347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEde++v+a++++G++ W+tIar+++ gRt++ +k++w++ 
  AHYPO_017899-RA  69 PFSPEEDEIIVKAHAKYGNK-WATIARHLN-GRTDNAIKNHWNST 111
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.3241061IPR017930Myb domain
SuperFamilySSF466892.78E-3312108IPR009057Homeodomain-like
SMARTSM007172.2E-171463IPR001005SANT/Myb domain
PfamPF002497.6E-191560IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-261668IPR009057Homeodomain-like
CDDcd001674.11E-161759No hitNo description
PROSITE profilePS5129426.19162116IPR017930Myb domain
SMARTSM007171.8E-1766114IPR001005SANT/Myb domain
CDDcd001677.30E-1469112No hitNo description
Gene3DG3DSA:1.10.10.605.0E-2569115IPR009057Homeodomain-like
PfamPF002494.7E-1769111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MENLQNLSLA ADRIKGPWSP EEDELLQRMV QKYGARNWSV ISKSIPGRSG KSCRLRWCNQ  60
LSPEVEHRPF SPEEDEIIVK AHAKYGNKWA TIARHLNGRT DNAIKNHWNS TLKRKFSSIT  120
SVGDEIFRPI KRPEISSSPP LSPTESDVSD SSGVVFRTSS GNLVEKNEDE PLLELSLCLP  180
GISENNNNAN TRSESTHQEV TRDGKETMSF GPELMMVMQE MIRKEVRHYM MEVDRNGGST  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-40141163105MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-39911652159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-39911652159MYB PROTO-ONCOGENE PROTEIN
1mse_C9e-40141163105C-Myb DNA-Binding Domain
1msf_C9e-40141163105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010691674.11e-115PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW16e-78MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0J8BJG11e-115A0A0J8BJG1_BETVU; Uncharacterized protein
STRINGBra012149.1-P2e-78(Brassica rapa)
STRINGGLYMA04G04490.12e-78(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.14e-79myb domain protein r1